PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g031820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 317aa    MW: 36060 Da    PI: 4.4075
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g031820.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.81.8e-082612942255
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +yp+  e++ LA+ +gL+ +q+ +WF N+R ++
  Sopen03g031820.1 261 WPYPTDGEKKSLAELTGLDPKQINNWFINQRKRH 294
                       59*****************************885 PP

2ELK25.14e-09214234222
               ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                       LK+ L+ KYsgy+ sLk+ F+
  Sopen03g031820.1 214 LKDKLMEKYSGYITSLKHDFC 234
                       9*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-1459103IPR005540KNOX1
PfamPF037908.8E-1961102IPR005540KNOX1
SMARTSM012567.2E-13113164IPR005541KNOX2
PfamPF037912.6E-18117162IPR005541KNOX2
SMARTSM011882.2E-4213234IPR005539ELK domain
PROSITE profilePS512138.573213233IPR005539ELK domain
PfamPF037897.7E-9214234IPR005539ELK domain
PROSITE profilePS5007111.386234297IPR001356Homeobox domain
SMARTSM003899.7E-9236301IPR001356Homeobox domain
SuperFamilySSF466898.98E-18240307IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-26240297IPR009057Homeodomain-like
CDDcd000862.42E-12242296No hitNo description
PfamPF059202.6E-16254293IPR008422Homeobox KN domain
PROSITE patternPS000270272295IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEEIMYEFGG YSDNHDLEAP EYFECPAEAF SDEELFGSAG NTRSLEVISA TNSSIVEEEN  60
IQAKISSHPL YTKLLLTYLH CRKVGAPPET VDMLDNIVQE NDLYRRSISS TALNQPISEN  120
SELDDFMVTY CDVLAKLKLD LGRSFNEATT FLNDIQTQLT NLSTTTNFSE EGAEAKAEAE  180
AEEGDRMGGE VNNGQQQKSS ISSIDESGSE INFLKDKLME KYSGYITSLK HDFCNKNYNK  240
GKLPKEATQI LLNWWTTHYN WPYPTDGEKK SLAELTGLDP KQINNWFINQ RKRHWKLPSQ  300
NMQFALMETT IYGHFSQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-161HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069479.10.0PREDICTED: homeobox protein knotted-1-like 2
TrEMBLK4BKC71e-105K4BKC7_SOLLC; Uncharacterized protein
STRINGSolyc03g112740.1.11e-104(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.19e-66KNOTTED1-like homeobox gene 6